PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI09G11520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 378aa    MW: 39212.2 Da    PI: 8.4246
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI09G11520.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.31.4e-4060133477
                      STT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   4 vegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      vegC +dls +k y+ rhkvC +h+k p v+v+gleqrfCqqCsrfh+l efD+ek+sCrrrLa+hnerrrk++
  OMERI09G11520.1  60 VEGCGVDLSGVKPYYCRHKVCYMHAKEPIVVVAGLEQRFCQQCSRFHQLPEFDQEKKSCRRRLAGHNERRRKPT 133
                      89**********************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114129.14555132IPR004333Transcription factor, SBP-box
PfamPF031101.5E-3160131IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-3760135IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.1E-2960119IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0042127Biological Processregulation of cell proliferation
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MATGGSGGGG GGGGGGGDDV HGLKFGKKIY FEQDAAAAVE SSSTSSGGGG GGGGKKGKGV  60
EGCGVDLSGV KPYYCRHKVC YMHAKEPIVV VAGLEQRFCQ QCSRFHQLPE FDQEKKSCRR  120
RLAGHNERRR KPTPGPLSSR YGRLAASFHE EPGRSRSFVV DFSYPRVPSS VRDAWPAIQP  180
GDRMSGSIQW QGGHELHPHR SSAVAGYGDH HAFSSHGGSA AGAPMLHHPA FELTSGGCLA  240
GVATDSSCAL SLLSTQPWDT TQSTSSHNRS PPMSSTASAF GGGNNPVSPS VMASNYMAAS  300
PGWNSSSRGH DGARNVHLPP PHGVALNEVP PGSVHHGHFS GELELALQGG ALSNRPEAEH  360
GSGSGAFSHS TNAMNWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-2848131184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0635610.0AK063561.1 Oryza sativa Japonica Group cDNA clone:001-117-F03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610961.10.0PREDICTED: squamosa promoter-binding-like protein 17 isoform X1
SwissprotA3C0570.0SPL17_ORYSJ; Squamosa promoter-binding-like protein 17
TrEMBLA0A0E0ETJ40.0A0A0E0ETJ4_9ORYZ; Uncharacterized protein
STRINGORGLA09G0114000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25273787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.15e-43squamosa promoter binding protein-like 9